Protein Info for BWI76_RS05615 in Klebsiella michiganensis M5al

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 20 to 466 (447 residues), 438.3 bits, see alignment E=4.1e-135 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 28 to 467 (440 residues), 495.6 bits, see alignment E=1.9e-152 PF13727: CoA_binding_3" amino acids 67 to 241 (175 residues), 77.1 bits, see alignment E=1.8e-25 PF02397: Bac_transf" amino acids 277 to 459 (183 residues), 225.2 bits, see alignment E=4.6e-71

Best Hits

KEGG orthology group: None (inferred from 78% identity to eae:EAE_12020)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsA, sugar transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZA3 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BWI76_RS05615 undecaprenyl-phosphate glucose phosphotransferase (Klebsiella michiganensis M5al)
MTDSTIKIYNARYSKLMKLMDFFAVNLFIFAYLKYFFVEPSTASLFLGIIYSLIFIRANE
HFQLYSGQFKGQYLKKLTKLFFSVCISGLLSFLLFVSAELLLNNHASTNAVRLAEIIVLC
SMAIFISMFLIRVISSRYFFKSRLKVAILGITPAGLAIEQALFKEYTHDGIDITFFEDRA
VQRDSRLLSIEKKGNSRDLLALAKAGEIDEVYIALPMVAQQRIRQFLNEFSDTTVDVFLV
PDLFSYSSHISQLRMFGNIQTISIFTSPFEGEGAVLKRIEDIVLGAFFTLVSLPVMLAVA
IGIKLTSPGPVLFKQNRYGLNGKQIPVWKFRTMRVMENSAVVTQATRNDPRITRFGAFLR
KTSLDELPQFFNVLQGTMSIVGPRPHAVAHNEQYRLLVENYMIRHKVKPGITGLAQIHGF
RGETDTIDKMEKRIQYDLEYIQSWSLLLDIKIVFLTFFRGFVGKNAF