Protein Info for BWI76_RS05575 in Klebsiella michiganensis M5al

Annotation: group 1 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF09314: DUF1972" amino acids 4 to 175 (172 residues), 30.5 bits, see alignment E=6.8e-11 PF13579: Glyco_trans_4_4" amino acids 18 to 175 (158 residues), 49.3 bits, see alignment E=1.8e-16 PF13439: Glyco_transf_4" amino acids 18 to 176 (159 residues), 58.3 bits, see alignment E=2.6e-19 PF13692: Glyco_trans_1_4" amino acids 200 to 332 (133 residues), 78.5 bits, see alignment E=1.6e-25 PF00534: Glycos_transf_1" amino acids 200 to 334 (135 residues), 85.4 bits, see alignment E=8.6e-28

Best Hits

KEGG orthology group: None (inferred from 83% identity to eae:EAE_11980)

Predicted SEED Role

"Alpha-D-GlcNAc alpha-1,2-L-rhamnosyltransferase (EC 2.4.1.-)" in subsystem Rhamnose containing glycans (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ20 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BWI76_RS05575 group 1 glycosyl transferase (Klebsiella michiganensis M5al)
MKLKVTVLGTRGIPNVQGGVETHCQNLYPEIYQQNHADICVIARSPYVDYRRSEYKGVRL
KSLWAPKSRKFEAIIHSTLAAFSTLFDGSNVVHVHAVGPGLVVPLLRLLGKRVVFTHHGP
DYDRQKWGKMAKEMLRLGEKWAVKYANEVIVISEVINTLIKTKHGRTNANVIYNGVRQPP
LPAEETRQATLNQYSLKAGQYIVAVARFVEEKGLHDLLAAYKASNCSLPLVLIGDADHPD
EYSERLKKQAAATPGAIMTGFISGDPLHTLFSQAGLFVLPSYHEGLPIALLEAMSWSLPV
IVSDIPANLEIGLPAEVYFPTGNVAALAQKLQSWRGEETVDYSQLMPKYRWPDIAAKTAQ
VYQRLTNKSQP