Protein Info for BWI76_RS05500 in Klebsiella michiganensis M5al

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 31 to 31 (1 residues), see Phobius details TIGR01938: NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit" amino acids 7 to 255 (249 residues), 312.9 bits, see alignment E=8.6e-98 PF04205: FMN_bind" amino acids 149 to 242 (94 residues), 56.6 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 69% identical to NQRC_YERPE: Na(+)-translocating NADH-quinone reductase subunit C (nqrC) from Yersinia pestis

KEGG orthology group: None (inferred from 88% identity to eae:EAE_11900)

MetaCyc: 55% identical to Na(+)-translocating NADH-quinone reductase subunit C (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit C (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYX3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BWI76_RS05500 NADH:ubiquinone reductase (Na(+)-transporting) subunit C (Klebsiella michiganensis M5al)
MAENKSNDSIGKTLLVVLVLCLVCSIVVAGSAVGLKSRQQEQRALDKQRNILAVAGLMKQ
GMSAEDVADIFKARISPRLVDLASGELLDKDPGKFNQAQALKDPQQSLQLDASQDPAGIK
RRSNIAEIYLVRDEKQQIQEIVLPIYGNGLWSVMYAFIALETDGRTLKGITYYDHGETPG
LGGEIENPNWRQQFIGKQVLDDKGMPALRIVKGGARPGDLHAVDGLSGATLTSNGVQHSF
DFWMGELGFGPFLHKVREGGLNNG