Protein Info for BWI76_RS05310 in Klebsiella michiganensis M5al

Annotation: tRNA(Ile)-lysidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF01171: ATP_bind_3" amino acids 16 to 193 (178 residues), 191.2 bits, see alignment E=2.2e-60 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 17 to 198 (182 residues), 162.7 bits, see alignment E=9.5e-52 PF09179: TilS" amino acids 243 to 310 (68 residues), 71.4 bits, see alignment E=9.1e-24 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 358 to 403 (46 residues), 56.5 bits, see alignment 1.4e-19 PF11734: TilS_C" amino acids 358 to 430 (73 residues), 77.2 bits, see alignment E=7.7e-26

Best Hits

Swiss-Prot: 68% identical to TILS_SHIFL: tRNA(Ile)-lysidine synthase (tilS) from Shigella flexneri

KEGG orthology group: None (inferred from 79% identity to eae:EAE_11740)

MetaCyc: 68% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU0 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BWI76_RS05310 tRNA(Ile)-lysidine synthetase (Klebsiella michiganensis M5al)
MMMIPDIAQTLRPHRQFLVAFSGGLDSSVLLYRLVRWREQDPTVQLRAMHIHHGLSVNAD
DWVAHCRLICQQWQVPLLVERVVLADEGLGIEAHARQARYQAFRSALLPGEALVTAQHLD
DQCETFLLALKRGSGPTGLSAMACESDFAGTKLLRPLLNESRDSLHRWAIAHQLSWIEDE
SNQDDAYDRNFLRLRIVPLLNARWPHFAEAVARSASLCGEQERLLDEMLAAELATLVAED
GALAIEPLTAMSAPRRAALLRRWLAGFNAPMPSREVPERIWREVAMAREDAFPCLRLGQF
TVRRFQQRLYWVKYLPGQSETVLAWPDIAKPLPLPGGLGELRFLPGGPLRGPRQDEAVTI
RFRASGHLHIVGRHGGRKLKKIWQELNVAPWRRDTTPLLFYGETLIAAADGLFITVDGKV
QEGEGVQLIWMETGG