Protein Info for BWI76_RS05295 in Klebsiella michiganensis M5al

Annotation: acetyl-CoA carboxylase carboxyl transferase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit" amino acids 2 to 319 (318 residues), 573.8 bits, see alignment E=5.4e-177 PF03255: ACCA" amino acids 5 to 151 (147 residues), 207.3 bits, see alignment E=9.2e-66 PF01039: Carboxyl_trans" amino acids 85 to 244 (160 residues), 66.3 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 98% identical to ACCA_KLEP7: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 99% identity to kpe:KPK_4535)

MetaCyc: 97% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ07 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BWI76_RS05295 acetyl-CoA carboxylase carboxyl transferase subunit alpha (Klebsiella michiganensis M5al)
MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGA
WQVAQLARHPRRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMEMAERFKMPIITFIDTPGAYPGVGAEERGQSEA
IARNLREMSRLSVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGIVAPRLKELKLIDSIIPEPLGGAHRNPEVMAASLKAQLLADLADLDVL
SEEELLNRRYQRLMSYGYA