Protein Info for BWI76_RS05210 in Klebsiella michiganensis M5al

Annotation: 30S ribosomal protein S2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR01011: ribosomal protein uS2" amino acids 3 to 226 (224 residues), 360.4 bits, see alignment E=1.4e-112 PF00318: Ribosomal_S2" amino acids 9 to 224 (216 residues), 323.2 bits, see alignment E=3e-101

Best Hits

Swiss-Prot: 99% identical to RS2_KLEP3: 30S ribosomal protein S2 (rpsB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 98% identity to ecf:ECH74115_0179)

MetaCyc: 98% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU4 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS05210 30S ribosomal protein S2 (Klebsiella michiganensis M5al)
MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKI
SSRKGKILFVGTKRAASEAVKDAANSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQ
SQDGTFDKLTKKEALMRTRELDKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLG
IPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLSAVAATVREGRSQDLASQAEESFVEA
E