Protein Info for BWI76_RS05205 in Klebsiella michiganensis M5al

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR00500: methionine aminopeptidase, type I" amino acids 3 to 250 (248 residues), 369.3 bits, see alignment E=4.7e-115 PF00557: Peptidase_M24" amino acids 12 to 242 (231 residues), 181.2 bits, see alignment E=1.1e-57

Best Hits

Swiss-Prot: 96% identical to MAP1_ECO57: Methionine aminopeptidase (map) from Escherichia coli O157:H7

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 97% identity to kpu:KP1_1020)

MetaCyc: 96% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYY4 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BWI76_RS05205 type I methionyl aminopeptidase (Klebsiella michiganensis M5al)
MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQKAVSACL
GYHGFPKSVCISINEVVCHGIPDDGKLLKDGDIVNIDVTVIKDDFHGDTSKMFIVGKPTI
LGERLCRITQESLYLALKMVKPGINLRAIGAAIQKYVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSPETNVVLKPGMTFTIEPMVNAGKKEIRSMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHNE