Protein Info for BWI76_RS05165 in Klebsiella michiganensis M5al

Annotation: cobalamin-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 26 to 227 (202 residues), 89.9 bits, see alignment E=9e-30

Best Hits

Swiss-Prot: 76% identical to BTUF_SALTY: Vitamin B12-binding protein (btuF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_11590)

MetaCyc: 74% identical to vitamin B12 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYT0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS05165 cobalamin-binding protein (Klebsiella michiganensis M5al)
MAKSLNAALAVLMLLAPAWLFAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPEAAKI
EQVSSWQGMNLERIVALKPDMVLAWRGGNAERQVNQLSSLGIKVIWVETSTIEDIIATLR
QLAQWSPQPEKARQAAQKMQDEYQTLKARYASGPKKRVFLQFGASPLFTTSKGSIQDQVL
TLCGGENIFAASRVPWPQVSREQVLARQPQAIVIAGDASQLPAVERYWQNQLKISFIALH
GDWFERASPRIILAAKQLCTALEQIK