Protein Info for BWI76_RS05080 in Klebsiella michiganensis M5al

Annotation: type II secretion protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 165 to 187 (23 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 42 (42 residues), 52.3 bits, see alignment 4.1e-18 TIGR02120: type II secretion system protein F" amino acids 4 to 398 (395 residues), 516.5 bits, see alignment E=3e-159 PF00482: T2SSF" amino acids 67 to 189 (123 residues), 118.2 bits, see alignment E=2.3e-38 amino acids 270 to 391 (122 residues), 93 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 70% identical to GSPF_PECCC: Type II secretion system protein F (outF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 83% identity to kpn:KPN_00158)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU5 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BWI76_RS05080 type II secretion protein F (Klebsiella michiganensis M5al)
MALFRYQALDEQGKPRRGVQQADSARHARQLLREKGWLALDIDPAAGGGRPSRFMRRTSA
RDLALVTRQLATLVAAAIPLEKALDAVAQQSEKPQLKTLIAGVRGKVLEGHSLAEAMRGH
PGCFDALYCAMVAAGEASGHLDGVLNRLADYTEQRQQLRARLLQAMIYPIVLTLVAVSVI
VILLSTVVPKVVEQFIHLKQALPFSTRLLMAMSDMLRAAGPWLLLAILLLILLLRYLLRQ
PAKRLAWHRLLLRLPLIGRVARSVNSARYARTLSILNASAVPLLLAMRISADVLSNAWAK
RQLEAASDAVREGVSLHRALEMTQLFPPMMRYMVASGERSGELNSMLERAADNQDRDLSA
QIQLALSLFEPLLVVAMAGMVLFIVLAILQPILQLNTLMSM