Protein Info for BWI76_RS05065 in Klebsiella michiganensis M5al

Annotation: type II secretion system protein GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 26 (26 residues), 33.6 bits, see alignment 2e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 26 (23 residues), 25.2 bits, see alignment 1e-09 TIGR01707: type II secretion system protein I" amino acids 6 to 105 (100 residues), 84.1 bits, see alignment E=8.3e-28 PF02501: T2SSI" amino acids 40 to 118 (79 residues), 91 bits, see alignment E=4e-30

Best Hits

Swiss-Prot: 100% identical to GSPI_KLEPN: Type II secretion system protein I (pulI) from Klebsiella pneumoniae

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 82% identity to kpe:KPK_4581)

Predicted SEED Role

"General secretion pathway protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYP5 at UniProt or InterPro

Protein Sequence (121 amino acids)

>BWI76_RS05065 type II secretion system protein GspI (Klebsiella michiganensis M5al)
MKKQSGMTLIEVMVALVVFALAGLAVMQATLQQTRQLGRMEEKTLASWLADNQLVQLRLE
NRWPALSWSETTLQAAGVSWHIRWQGVETDLPQLRALDVEVRHAKSDKTPVSSLRTYVTS
P