Protein Info for BWI76_RS05035 in Klebsiella michiganensis M5al

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 204 to 235 (32 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF06750: A24_N_bact" amino acids 26 to 111 (86 residues), 103.9 bits, see alignment E=3.9e-34 PF01478: Peptidase_A24" amino acids 124 to 233 (110 residues), 96.3 bits, see alignment E=1.4e-31

Best Hits

Swiss-Prot: 100% identical to LEP4_KLEPN: Type 4 prepilin-like proteins leader peptide-processing enzyme (pulO) from Klebsiella pneumoniae

KEGG orthology group: K02464, general secretion pathway protein O [EC: 2.1.1.- 3.4.23.43] (inferred from 74% identity to kpu:KP1_0977)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYY7 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BWI76_RS05035 prepilin peptidase (Klebsiella michiganensis M5al)
MVENIALLPEFAAQYPFLWGSFLFLSGLAFGSFFNVVIHRLPLMMEQAEGINLCFPASFC
PQCREPIAWRDNIPLLGFLFLKGRSRCCGQPISPRYPLMELATGALFVLAGYLMAPGVPL
LGGLILLSLLLILAAIDAQTQLLPDGLTLPLMWAGLLFNLSATYVPLAEAVVGAMAGYLS
LWSVYWVFRLLSGKEALGYGDFKLLAALGAWLGWQALPQTLLLASASGLVWTLLQRLITR
QSLQQPLAFGPWLALAGGGIFLWSQIYPPIFPVALR