Protein Info for BWI76_RS05005 in Klebsiella michiganensis M5al

Annotation: polynucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR01942: poly(A) polymerase" amino acids 31 to 457 (427 residues), 526.4 bits, see alignment E=2.6e-162 PF01743: PolyA_pol" amino acids 63 to 193 (131 residues), 136.1 bits, see alignment E=1.3e-43 PF12627: PolyA_pol_RNAbd" amino acids 221 to 281 (61 residues), 68.2 bits, see alignment E=6.2e-23 PF12626: PolyA_pol_arg_C" amino acids 338 to 457 (120 residues), 141.2 bits, see alignment E=2.4e-45

Best Hits

Swiss-Prot: 89% identical to PCNB_ECOLI: Poly(A) polymerase I (pcnB) from Escherichia coli (strain K12)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 94% identity to kpu:KP1_0971)

MetaCyc: 89% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU8 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BWI76_RS05005 polynucleotide adenylyltransferase (Klebsiella michiganensis M5al)
MFTRVANFCRKVLSREEREAEAAVEQLHMTVIPREQHAISRKDISENALKVMYRLNKAGY
ESWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEV
ATFRGHHEGHTTDRITSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDY
VGGMKDLQDGVVRLIGDPETRYREDPVRMLRAVRFAAKLSMSISEETAEPIPRLATLLHD
VPPARLFEEVLKLLQAGDGYETYILLREYNLFQPLFPTITRYFTERGDSPMERIISQVLK
NTDTRIRNDMRVNPAFLFAVMFWYPLLETAQKIAQESGLAYYDAFALAMNDVLDEACRTL
AIPKRITTLVRDIWQLQLRMSRRQGKRAWKLMEHPKFRAAYDLLELRAGAENSSELQRLT
KWWGEFQVAAPPDQKDMLDDLGDDPAPRRRHRRPRKRAPRREGSA