Protein Info for BWI76_RS04990 in Klebsiella michiganensis M5al

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to PANC_KLEP3: Pantothenate synthetase (panC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 89% identity to kpe:KPK_4596)

MetaCyc: 87% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
superpathway of coenzyme A biosynthesis II (plants) (5/10 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYP1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BWI76_RS04990 pantoate--beta-alanine ligase (Klebsiella michiganensis M5al)
MLIIETLPLLRQHIRRLRQEGKRIALVPTMGNLHDGHMKLVDTAKASADVVVASIFVNPM
QFDRAEDLARYPRTLQDDCEKLNKRKVDLVFAPAAAEIYPQGTESQTYVDVPGLSTMLEG
ASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDFQQLALIRKMVADMGYDIEIIGVPIMRA
KDGLALSSRNGYLSAEQRKIAPGLYKVMNRAAEKLAAGERNLDEIIAIAGQELNEKGFRA
DDIQIRDADTLLDLTENSQRAVILMAAWLGEARLIDNQIVALAR