Protein Info for BWI76_RS04970 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 58 to 84 (27 residues), see Phobius details amino acids 105 to 132 (28 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 9 to 218 (210 residues), 135.9 bits, see alignment E=1.5e-43 PF12698: ABC2_membrane_3" amino acids 58 to 245 (188 residues), 34.9 bits, see alignment E=9.6e-13

Best Hits

Swiss-Prot: 94% identical to YADH_ECOL6: Inner membrane transport permease YadH (yadH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 94% identity to eco:b0128)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYP6 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS04970 ABC transporter permease (Klebsiella michiganensis M5al)
MMQLYWVALKSIWTKEIHRFMRIWIQTLVPPVITMTLYFVIFGNLIGSRIGEMHGFTYMQ
FIVPGLIMMAVITNAYANVASSFFSAKFQRNIEELLVAPVPTHVVIAGYVGGGVARGLCV
GILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNAVFAKTFDDISLIPTFVLTP
LTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGINDVPLATTFGVLVVFIVAF
YILCWYLIQRGRGLRS