Protein Info for BWI76_RS04865 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 11 to 446 (436 residues), 422.2 bits, see alignment E=1.1e-130 PF13347: MFS_2" amino acids 13 to 432 (420 residues), 319.6 bits, see alignment E=2.7e-99 PF07690: MFS_1" amino acids 25 to 347 (323 residues), 51.1 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 46% identical to YICJ_ECOLI: Inner membrane symporter YicJ (yicJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_11365)

Predicted SEED Role

"Possible GPH family transporter (TC 2.A.2) for arabinosides" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYS8 at UniProt or InterPro

Protein Sequence (468 amino acids)

>BWI76_RS04865 MFS transporter (Klebsiella michiganensis M5al)
MNGNKLSVKEKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPALVGVLLLSVRVIDAV
TDPIMGAMADRTRSKYGRFRPWLLWIAFPYALFSVLMFTTPEWTYNSKVIYAFVTYFLLS
LTYTAINIPYCSLGSVITNDPQERVACQSYRFVMVGIATLLLSLTLLPMADWFGGEDKAK
GYQMAMTVLAFIGMCMFLFCFATVRERVKPAVQTNDELKKDLKDVWKNDQWVRILLLTLC
NVCPGFIRMAATMYYVTWVMQQSTHFATLFISLGVVGMMIGSMLAKVLTDRWCKLQVFFW
TNIVLAVFSCAFYFFDPHATMMIMALYFLLNILHQIPSPLHWSLMADVDDYGEWKTGKRI
TGISFSGNLFFLKVGLAIAGAMVGFLLSWYGYDAGAKQQSASAINGIVLLFSVIPGVGYL
ITAGVVRMLKVNREFMRQIQSDLEKRRVNYSELNDYQELKTGEHVRKA