Protein Info for BWI76_RS04845 in Klebsiella michiganensis M5al
Annotation: nicotinate-nucleotide pyrophosphorylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to NADC_SALTY: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 95% identity to kva:Kvar_4271)MetaCyc: 85% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]
Predicted SEED Role
"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- NAD de novo biosynthesis I (5/6 steps found)
- NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
- NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
- NAD de novo biosynthesis III (4/6 steps found)
- superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
- NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)
- nicotine biosynthesis (3/9 steps found)
- superpathway of nicotine biosynthesis (4/12 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Nicotinate and nicotinamide metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AYU3 at UniProt or InterPro
Protein Sequence (297 amino acids)
>BWI76_RS04845 nicotinate-nucleotide pyrophosphorylase (Klebsiella michiganensis M5al) MTPRRYNPDRRRDALLERINLDITDAVAQSLREDLGGEVDANNDISAQLLPQDARSHAVV ITREDGVFCGKRWVEEVFIQLAGDDVNFTWHVADGDAVKANQPLFELDGPSRILLTGERT ALNFVQTLSGVASEVRRYVDLLAGTKTQLLDTRKTLPGLRTALKYAVLCGGGANHRLGLS DAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVETLEELDEALKAGADIIMLDNFTT DLMREAVKLTQGQAALEVSGNVTFDTIREFAETGVDYISVGALTKHVRALDLSMRFR