Protein Info for BWI76_RS04845 in Klebsiella michiganensis M5al

Annotation: nicotinate-nucleotide pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 27 to 296 (270 residues), 334.2 bits, see alignment E=2.6e-104 PF02749: QRPTase_N" amino acids 44 to 129 (86 residues), 71.9 bits, see alignment E=4e-24 PF01729: QRPTase_C" amino acids 131 to 295 (165 residues), 208.4 bits, see alignment E=6.2e-66

Best Hits

Swiss-Prot: 87% identical to NADC_SALTY: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 95% identity to kva:Kvar_4271)

MetaCyc: 85% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>BWI76_RS04845 nicotinate-nucleotide pyrophosphorylase (Klebsiella michiganensis M5al)
MTPRRYNPDRRRDALLERINLDITDAVAQSLREDLGGEVDANNDISAQLLPQDARSHAVV
ITREDGVFCGKRWVEEVFIQLAGDDVNFTWHVADGDAVKANQPLFELDGPSRILLTGERT
ALNFVQTLSGVASEVRRYVDLLAGTKTQLLDTRKTLPGLRTALKYAVLCGGGANHRLGLS
DAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVETLEELDEALKAGADIIMLDNFTT
DLMREAVKLTQGQAALEVSGNVTFDTIREFAETGVDYISVGALTKHVRALDLSMRFR