Protein Info for BWI76_RS04835 in Klebsiella michiganensis M5al

Annotation: type II secretion system protein GspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 333 to 351 (19 residues), see Phobius details PF05157: MshEN" amino acids 9 to 50 (42 residues), 23.1 bits, see alignment 6e-09 PF00437: T2SSE" amino acids 78 to 453 (376 residues), 464.1 bits, see alignment E=2.6e-143

Best Hits

Swiss-Prot: 70% identical to HOFB_ECOLI: Protein transport protein HofB homolog (hofB) from Escherichia coli (strain K12)

KEGG orthology group: K02504, protein transport protein HofB (inferred from 85% identity to kpu:KP1_0930)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYJ8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BWI76_RS04835 type II secretion system protein GspE (Klebsiella michiganensis M5al)
MKTEQLIPLCQRYKALLLDSDEHTIAIAVVDAPAPELMEALRFATQKRIDIECWSQDRMD
KRLQTPGISTLAPPVEASASVVEQVNNLLEQALRQRASDIHIEPGDDRLRIRLRVDGVLH
SLAPLAAELAAPITARLKVLGNLDIAEHRVPQDGQFTLTLSERPISFRIATLPCRGGEKI
VLRLLHQVEQALDLEALGLSSQQLAAFRSALNQPQGLMLVTGPTGSGKTVTLYSALQARN
RDEVNICSVEDPLEIPIVGMNQTQINPRAGLTFHSVLRALLRQDPDIVMVGEIRDAETAE
IAIKAAQTGHLVLSTLHTNSTSETLVRLQQMGVARWMISSALSLVVAQRLVRKLCPHCRR
ETGSSADVPHSLWPRALPRWQAPGCQHCYHGYYGRLALFELLPVNTTLRQAITQGLSAGE
IESLARESGMMTLFESGCLAVERGMTSLEEVVRVLGIPHGD