Protein Info for BWI76_RS04750 in Klebsiella michiganensis M5al

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details PF21799: MurD-like_N" amino acids 7 to 94 (88 residues), 122.8 bits, see alignment E=8.4e-40 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 8 to 435 (428 residues), 428.1 bits, see alignment E=2.4e-132 PF08245: Mur_ligase_M" amino acids 110 to 280 (171 residues), 85.9 bits, see alignment E=5.8e-28 PF02875: Mur_ligase_C" amino acids 302 to 414 (113 residues), 52.3 bits, see alignment E=1.6e-17

Best Hits

Swiss-Prot: 89% identical to MURD_ECOL5: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_11250)

MetaCyc: 89% identical to UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase. [EC: 6.3.2.9]

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYJ3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BWI76_RS04750 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Klebsiella michiganensis M5al)
MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPAGLDKLPEAVERYVGGLNE
DWLLTADLIVASPGIALAHPSLSAAADAGVEIVGDIELFCREAQAPIIAITGSNGKSTVT
SLVGEMAKAAGLNVGVGGNIGLPALMLLDPERELYVLELSSFQLETTSSLRAVAATILNV
TEDHMDRYPLGLQQYRAAKLRVYENARACIVNADDALTMPVRGADDRCISFGVDVGDYHL
NRQQGETWLRVKGEKVLNVKEMKISGQHNYSNALAALALADAAGLPRASSLKALTTFTGL
AHRFQQVLEHNGVRWINDSKATNVGSTEAALNGLHLDGTLYLLLGGDGKSADFTPLSRYL
TGDHVRLYCFGRDGAQLAALRPDVAVQTETMEQAMRQIAPQVVPGDMVLLSPACASLDQF
KNFEQRGDVFARLAKELG