Protein Info for BWI76_RS04705 in Klebsiella michiganensis M5al

Annotation: DNA-binding transcriptional regulator FruR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 328 (327 residues), 510.5 bits, see alignment E=9.6e-158 PF00356: LacI" amino acids 3 to 50 (48 residues), 65.7 bits, see alignment 5.1e-22 PF00532: Peripla_BP_1" amino acids 62 to 312 (251 residues), 52.5 bits, see alignment E=1e-17 PF13407: Peripla_BP_4" amino acids 64 to 282 (219 residues), 37.2 bits, see alignment E=4.9e-13 PF13377: Peripla_BP_3" amino acids 183 to 330 (148 residues), 41 bits, see alignment E=4.5e-14

Best Hits

Swiss-Prot: 97% identical to CRA_ECO57: Catabolite repressor/activator (cra) from Escherichia coli O157:H7

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 98% identity to kpu:KP1_0900)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYM8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>BWI76_RS04705 DNA-binding transcriptional regulator FruR (Klebsiella michiganensis M5al)
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGR
TRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDA
IIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGADQDDAEMLGAELRKFPAE
TVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYEREAAAQLFEKWLETHPMPQ
ALFTTSFPLLQGVMDVTLRREGKLPSELAIATFGDNELLDFLQCPVLAVAQRHRDVAERV
LEIVLASLDEPRKPKPGLSRIRRNLYRRGSLNRR