Protein Info for BWI76_RS04655 in Klebsiella michiganensis M5al

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00507: shikimate dehydrogenase" amino acids 11 to 285 (275 residues), 221.1 bits, see alignment E=7.6e-70 PF08501: Shikimate_dh_N" amino acids 14 to 96 (83 residues), 107.4 bits, see alignment E=3.6e-35 PF18317: SDH_C" amino acids 257 to 283 (27 residues), 47.5 bits, see alignment (E = 1.1e-16)

Best Hits

Swiss-Prot: 79% identical to AROE_LISIN: Shikimate dehydrogenase (NADP(+)) (aroE) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_11160)

MetaCyc: 51% identical to quinate/shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Quinate/shikimate dehydrogenase. [EC: 1.1.1.282]; 1.1.1.282 [EC: 1.1.1.282]

Predicted SEED Role

"Shikimate/quinate 5-dehydrogenase I beta (EC 1.1.1.282)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 1.1.1.282)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.282

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYM0 at UniProt or InterPro

Protein Sequence (287 amino acids)

>BWI76_RS04655 shikimate dehydrogenase (Klebsiella michiganensis M5al)
MAERITGHTELIGLIATPIRHSMSPTMHNEAFAHLGLDYVYLAFEVGNEELKDVVQGFRA
LKLRGCNVSMPNKTEICQYLDKLSPAAELVGAVNTVVNDNGVLTGHITDGTGYMRALKEE
GIDIIGKKMTVLGAGGAATALCVQAALDGVKAISIFNRKDKFFANAEQTVAKIRNNTRCE
IHLFDLDDHDKLRAEIDSSVILTNATGVGMKPFEGQMLLPDDSFLRPDLIVSDVVYNPRK
TYLLEVAEKKGCRTINGLGMMLWQGARAFEIWTGKEMPVEHIKSILF