Protein Info for BWI76_RS04595 in Klebsiella michiganensis M5al

Annotation: DNA-binding transcriptional regulator AraC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF02311: AraC_binding" amino acids 26 to 160 (135 residues), 82.1 bits, see alignment E=4.7e-27 PF00165: HTH_AraC" amino acids 186 to 226 (41 residues), 29.2 bits, see alignment 1.2e-10 amino acids 240 to 277 (38 residues), 34.6 bits, see alignment 2.4e-12 PF12833: HTH_18" amino acids 201 to 278 (78 residues), 77.1 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 92% identical to ARAC_SALTY: Arabinose operon regulatory protein (araC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_11100)

Predicted SEED Role

"Arabinose operon regulatory protein" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYF7 at UniProt or InterPro

Protein Sequence (281 amino acids)

>BWI76_RS04595 DNA-binding transcriptional regulator AraC (Klebsiella michiganensis M5al)
MAETQNDPLLPGYSFNAHLVTGLTPIDADGYLDFFIDRPLGMKGYILNLTIRGEGVINNH
GEQFICRPGDMLLFPPGEIHHYGRHPDAREWYHQWVYFRPRAYWHEWLNWPTIFAQTGFF
RPDEQWQTRFGELFGQIVEAGQGAGRYSELLAINLMEQLLLRRMEAINESLHPPLDNRVR
DACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGISVLGWREDQRISQAKLLLS
TTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE