Protein Info for BWI76_RS04555 in Klebsiella michiganensis M5al

Annotation: citrate/acetate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 211 (28 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 362 to 385 (24 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details PF03390: 2HCT" amino acids 36 to 442 (407 residues), 470.8 bits, see alignment E=1.7e-145

Best Hits

Swiss-Prot: 38% identical to MAEN_BACSU: Na(+)-malate symporter (maeN) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to kpe:KPK_4687)

Predicted SEED Role

"Malate Na(+) symporter" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYF3 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BWI76_RS04555 citrate/acetate antiporter (Klebsiella michiganensis M5al)
MSTTDNAFPATIDPINTPKAPLKQRWWHILDNWKVGIIPLPLFLLAGGLIALDCLGGKLP
SDIVVMVATLAFFGFACGEFGKRLPILGKLGAAAICATFIPSALVHYGLLPDVVVESTTK
FYKSTNILYLYICCIIVGSIMSMNRTTLIQGFMRIFFPMLCGEIVGMVVGVGVGTALGLE
PFQVFFFIVLPIMAGGVGEGAIPLSIGYAALMHMDQGVALGRVLPMVMLGSLTAIVIAGG
LNQLGKRFPHLTGEGQLMPNRRNETHRETPAEGKMDVTTLASGALLAVLLYMLGMLGQKT
IGLPAPVGMLFLAVLLKLVNGVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELV
NAFTLTNLLVIISTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTSGNR
MNLMPFAQIATRIGGAINVSLGLLFLSHFLA