Protein Info for BWI76_RS04275 in Klebsiella michiganensis M5al
Annotation: molybdopterin adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to MOG_SHIFL: Molybdopterin adenylyltransferase (mog) from Shigella flexneri
KEGG orthology group: None (inferred from 95% identity to eae:EAE_10715)MetaCyc: 91% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]
Predicted SEED Role
"Molybdopterin biosynthesis molybdochelatase MogA"
MetaCyc Pathways
- molybdenum cofactor biosynthesis (3/3 steps found)
- bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.75
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AYA1 at UniProt or InterPro
Protein Sequence (195 amino acids)
>BWI76_RS04275 molybdopterin adenylyltransferase (Klebsiella michiganensis M5al) MNTLRIGLVSISDRASSGVYQDKGIPALEAWLARALSTPFELQTRLIPDEQVIIEQTLCE LVDEMGCHLVLTTGGTGPARRDVTPDATLAIADRVMPGFGEQMRQVSLHFVPTAILSRQV GVIRKQALILNLPGQPKAIEETLEGVKDAEGNVLVHGVFASVPYCVQLLEGPYVETNGEV VAAFRPKSARRETLS