Protein Info for BWI76_RS04255 in Klebsiella michiganensis M5al

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 92% identical to THRC_ECOLI: Threonine synthase (thrC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_10695)

MetaCyc: 92% identical to threonine synthase (Escherichia coli K-12 substr. MG1655)
Threonine synthase. [EC: 4.2.3.1]

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

aspartate superpathway (24/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY99 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BWI76_RS04255 threonine synthase (Klebsiella michiganensis M5al)
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDEMLQQDLVSRSAKILS
AFIGDEIPQDVLQARIGNAFTFPAPVSKVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLQDGNWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDETTKETMRELKAIGYTSEPHAAIAYRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELAERADLPLLSHNLPADFAAL
RKLMMG