Protein Info for BWI76_RS04200 in Klebsiella michiganensis M5al

Annotation: phosphoglycerate mutase GpmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 147 to 167 (21 residues), see Phobius details PF00300: His_Phos_1" amino acids 4 to 194 (191 residues), 193.6 bits, see alignment E=1.5e-61

Best Hits

Swiss-Prot: 97% identical to GPMB_KLEP7: Probable phosphoglycerate mutase GpmB (gpmB) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 97% identity to kpu:KP1_0812)

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY83 at UniProt or InterPro

Protein Sequence (215 amino acids)

>BWI76_RS04200 phosphoglycerate mutase GpmB (Klebsiella michiganensis M5al)
MLQVYLVRHGETQWNAERRIQGQSDSPLTAHGERQAWQVGERARTLGITHIIASDLGRTR
RTAEIIAEACGCSVVTDSRLRELDMGVLEKRHIDSLSEEEEGWRRQLVNGTPDGRIPQGE
SMQELSERMHAALTSCLELPAGSRPLLVSHGMALGCLVSTILGLPAYAERRLRLRNCSIS
RVDYQQSPWLASGWVVETAGDVSHLDAPAMDELQR