Protein Info for BWI76_RS04005 in Klebsiella michiganensis M5al

Annotation: primosomal protein DnaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF17948: DnaT" amino acids 89 to 158 (70 residues), 77.1 bits, see alignment E=3.5e-26

Best Hits

Swiss-Prot: 86% identical to DNAT_KLEP7: Primosomal protein 1 (dnaT) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_10475)

MetaCyc: 75% identical to primosomal protein DnaT (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Primosomal protein I" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY48 at UniProt or InterPro

Protein Sequence (179 amino acids)

>BWI76_RS04005 primosomal protein DnaI (Klebsiella michiganensis M5al)
MSSRILTTDFSGLDDFMQDHAAVLAKSAGGAVAVFANNAPAFYALTPERLAQLLELEAKL
ARPNSDIALDAQFFDEPTAVPVAVPMGKFPMYADWQPDADFQRLAALWGIALSQPVTPEE
LAAFVAYWQAEGKVFHHVQWQQKLARSVQIGRASNGGQPRRDVNAISEPENHIPRGFRG