Protein Info for BWI76_RS03925 in Klebsiella michiganensis M5al

Annotation: N-acetyltransferase GCN5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00583: Acetyltransf_1" amino acids 46 to 130 (85 residues), 71.5 bits, see alignment E=3.4e-23 amino acids 207 to 238 (32 residues), 22.2 bits, see alignment 6.8e-08 PF13508: Acetyltransf_7" amino acids 57 to 132 (76 residues), 50.7 bits, see alignment E=9e-17 PF08445: FR47" amino acids 61 to 133 (73 residues), 32.7 bits, see alignment E=2.8e-11 PF13673: Acetyltransf_10" amino acids 64 to 132 (69 residues), 40.1 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 73% identity to eae:EAE_10455)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYA8 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BWI76_RS03925 N-acetyltransferase GCN5 (Klebsiella michiganensis M5al)
MELTAVPATQFSIEQLTTILCDCFEDYLVPVTLSVEVFVQRFSAEGLSLLDSRVWLDGDV
PAAMAVVARRGDEARLAAFAVRPAYRGKGVGRRLMTPLIDALRAQGVRRMWLEVIRDNHA
AVALYQSLGFEVRHGLCGYLSAQAASGESSVLQEYDVLALTRRAGAEINGQLPWLMDPLT
FSTLPCRALSLHQQAFAVLATLSSRPQLQFLWVDPAARGRGLGQEMLRALAQRFPGLGTS
VTIPERFTPLFHAAGYTPMALKQYEMSAALSALPSAGR