Protein Info for BWI76_RS03835 in Klebsiella michiganensis M5al

Annotation: 4-hydroxyphenylacetate catabolism regulatory protein HpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR02297: 4-hydroxyphenylacetate catabolism regulatory protein HpaA" amino acids 6 to 291 (286 residues), 392.2 bits, see alignment E=6.6e-122 PF02311: AraC_binding" amino acids 37 to 149 (113 residues), 29.6 bits, see alignment E=1.1e-10 PF07883: Cupin_2" amino acids 39 to 99 (61 residues), 33.2 bits, see alignment E=6.8e-12 PF12833: HTH_18" amino acids 213 to 290 (78 residues), 72.5 bits, see alignment E=6e-24 PF00165: HTH_AraC" amino acids 255 to 290 (36 residues), 28.5 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: K02508, AraC family transcriptional regulator, 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein (inferred from 92% identity to enc:ECL_00751)

Predicted SEED Role

"Transcriptional activator of 4-hydroxyphenylacetate 3-monooxygenase operon, XylS/AraC family" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AY09 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS03835 4-hydroxyphenylacetate catabolism regulatory protein HpaA (Klebsiella michiganensis M5al)
MCQSPVTNIDMNKEYDESLGTEEVHYQSFARMAEFFGRDMQAHRHDQYFQMHFLDTGQIE
LQLDDHRYSVQAPLFVLTPPSVPHAFITESDSDGHVLTVREDLVWPLLEVLYPGTREAFG
LPGICLSLADKPEELAALAHYWRLIERESTSQLPGREHTLTLLAQAVFTLLLRNAKLDDH
AASGIRGELKLFQRFNQLIDSHYHQHWTVPDYACELHLTESRLTDICRRFANRPPKRLIF
DRQLREARRLLLFSDSTIGEIAWQLGFKDPAYFARFFNRLTGCSPSAFRTQKVPVS