Protein Info for BWI76_RS03825 in Klebsiella michiganensis M5al

Annotation: 4-hydroxyphenylacetate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02296: 4-hydroxyphenylacetate 3-monooxygenase, reductase component
  • amino acids 10 to 163 (154 residues), 260.6 bits, E=2.3e-82
• PF01613: Flavin_Reduct
  • amino acids 14 to 162 (149 residues), 118.7 bits, E=1.2e-38

Best Hits

Swiss-Prot: 94% identical to HPAC_KLEOX: 4-hydroxyphenylacetate 3-monooxygenase reductase component (hpaC) from Klebsiella oxytoca

KEGG orthology group: K00484, 4-hydroxyphenylacetate-3-hydroxylase small chain [EC: 1.14.13.3] (inferred from 93% identity to kpn:KPN_04779)

MetaCyc: 86% identical to HpaC (Escherichia coli W)
RXN-12446 [EC: 1.5.1.36]

Predicted SEED Role

"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)

KEGG Metabolic Maps

• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.3

Use Curated BLAST to search for 1.14.13.3 or 1.5.1.36 or 1.6.8.-

Sequence Analysis Tools

See A0A285AY39 at UniProt or InterPro

Protein Sequence (170 amino acids)

>BWI76_RS03825 4-hydroxyphenylacetate 3-monooxygenase (Klebsiella michiganensis M5al)
MQLDEQRLRFRDAMASLSAAVNVITTEGEAGRCGITATAVCSVTDTPPSVMVCINANSAM
NPVFQGNGKLCINVLNHEQEEMARHFAGMTGMTMDDRFGLSGWQKGALGQPVLKGALASL
EGEISQVQTIGSHLVYLVEIRNITLSQQGHGLIYFKRRFHPVMMEMDVVA