Protein Info for BWI76_RS03430 in Klebsiella michiganensis M5al

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00106: adh_short" amino acids 11 to 168 (158 residues), 105.9 bits, see alignment E=4e-34 PF01370: Epimerase" amino acids 13 to 82 (70 residues), 22.4 bits, see alignment E=1.5e-08 PF08659: KR" amino acids 13 to 99 (87 residues), 31.4 bits, see alignment E=3.5e-11 PF13561: adh_short_C2" amino acids 22 to 273 (252 residues), 147.7 bits, see alignment E=8.6e-47

Best Hits

KEGG orthology group: None (inferred from 51% identity to rce:RC1_3770)

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXY0 at UniProt or InterPro

Protein Sequence (275 amino acids)

>BWI76_RS03430 short-chain dehydrogenase (Klebsiella michiganensis M5al)
MEDTLFSVKDKVIIVTGGLGQLGAQYVKTLHDRGAKVAALATRVDAARVDRVLGAIKDSD
RLLCAEVNITDKASINRVLDSIEAKWGVPDGLVNNAGVDTQPSAPPEVSGPFEEFPEEVF
REVVEVNLVGTFLMTQQVGKRMKQAGKGGSIINVGSIYGVVSPVQDIYSYKKEDTGIPFV
KPVAYSAAKSGLYNFTRYCATYWGRDGIRVNTLTLSGVERSDQDPRFQKNYTSRIPIGRM
AKAHEYNGAVVFLLSDASVYMTGSNVVVDGGWTAW