Protein Info for BWI76_RS03315 in Klebsiella michiganensis M5al

Annotation: clavaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 13 to 211 (199 residues), 182 bits, see alignment E=1.9e-57 PF08659: KR" amino acids 13 to 183 (171 residues), 47.5 bits, see alignment E=4e-16 PF01370: Epimerase" amino acids 14 to 184 (171 residues), 36.1 bits, see alignment E=9.8e-13 PF13561: adh_short_C2" amino acids 18 to 237 (220 residues), 127.5 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: None (inferred from 68% identity to msm:MSMEG_5568)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>BWI76_RS03315 clavaldehyde dehydrogenase (Klebsiella michiganensis M5al)
MDMSTLKTLSGSVALVTGASSGIGQATALKLADAGARVALIARRVDRLEALAEKIRGAGG
QALPIEADITLPNVASQTIEQVISEYGRLDTLVNAAGVMLNGPSIDAPLEEWDQMVDVNL
RGLMYVTKAALPHLIASVTTSLRKVVDVVNISSVAGRVAAAQVAIYNATKFAVTGATEAW
RQEFTKQSVRFSVIEPGATETELWKQEGQWESFKVAFGEVERLYAEDIAKAVEFIVTNPR
RVAINEIVVRPTDQA