Protein Info for BWI76_RS03100 in Klebsiella michiganensis M5al
Annotation: protein iolH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to IOLH_BACSU: Protein IolH (iolH) from Bacillus subtilis (strain 168)
KEGG orthology group: K06605, myo-inositol catabolism protein IolH (inferred from 98% identity to kpn:KPN_04676)Predicted SEED Role
"Glyceraldehyde-3-phosphate ketol-isomerase (EC 5.3.1.1)" in subsystem Inositol catabolism (EC 5.3.1.1)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of N-acetylneuraminate degradation (22/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
- superpathway of hexitol degradation (bacteria) (18/18 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- superpathway of anaerobic sucrose degradation (18/19 steps found)
- gluconeogenesis I (13/13 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- homolactic fermentation (12/12 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- glycolysis IV (8/10 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- glycerol degradation to butanol (12/16 steps found)
- gluconeogenesis III (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- glycolysis VI (from fructose) (8/11 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- sucrose degradation V (sucrose α-glucosidase) (3/5 steps found)
- oxygenic photosynthesis (11/17 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
KEGG Metabolic Maps
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Inositol phosphate metabolism
Isozymes
Compare fitness of predicted isozymes for: 5.3.1.1
Use Curated BLAST to search for 5.3.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AWX5 at UniProt or InterPro
Protein Sequence (294 amino acids)
>BWI76_RS03100 protein iolH (Klebsiella michiganensis M5al) MKIAFDVDVIKDLGVTRMVHQVAEWGYKYIEQSPHPQINPFYKHPRASREIMAEYKQALR DTGVELSSFICVYRWSGPDELRRQAAVKNWKRLIEIAVEMGVQVINTEFSGDPNQPEICD EMFYRSMEELLPIFEREGIRVEIQAHPWDFCEENNETVDIVKSFRSDNVKYVYSVPHTFF YDKGVGDVEKMLRYAGSDLSHVLIADTRNHTKHCRYIVNPPGVDAVVHQHVGVGEGDVDF DALFRTLRDMKFAEQTFKVGGEPIVATSLFGYPEKMKYQAVETRELIERELLRR