Protein Info for BWI76_RS03095 in Klebsiella michiganensis M5al

Updated annotation (from data): Inositol 2-dehydrogenase (EC 1.1.1.18)
Rationale: Specifically important for utilizing m-Inositol. Automated validation from mutant phenotype: the predicted function (1.1.1.18) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: NADH-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF01408: GFO_IDH_MocA" amino acids 4 to 125 (122 residues), 95.6 bits, see alignment E=5.4e-31 PF22725: GFO_IDH_MocA_C3" amino acids 133 to 248 (116 residues), 67.1 bits, see alignment E=2.2e-22 PF02894: GFO_IDH_MocA_C" amino acids 137 to 326 (190 residues), 85.6 bits, see alignment E=6.7e-28

Best Hits

Swiss-Prot: 98% identical to IOLG_KLEP3: Inositol 2-dehydrogenase (iolG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 97% identity to kpu:KP1_0560)

MetaCyc: 95% identical to myo-inositol 2-dehydrogenase (Klebsiella aerogenes)
Inositol 2-dehydrogenase. [EC: 1.1.1.18]

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWY4 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BWI76_RS03095 Inositol 2-dehydrogenase (EC 1.1.1.18) (Klebsiella michiganensis M5al)
MSLKLGVIGAGAIGKEHIRRCTQVLQGATVVAVSDINEENARAAVALPGVHAEVYADGHD
VIKASDVDAILVTSWDPTHEEYTLAAIAAGKPVFCEKPLAMSAEGCRRIVDAEMKAGRRL
VQVGFMRPYDEGYLALKKVIDDGDIGAPLMLRCAHRNQSVGENYTTDMAITNTLIHELDV
LRWLLNDDYRSVQVRFPRSTSHTHARLKDPQIVSFETKKGTLIDVEVFVNCQYGYDIQCE
VVGETGIARLPEPSAVQMRKAANLSTAILTDWKDRFIKAYDVELQAFINDVQAGQLHGPS
AWDGYAASVAADACIKAQGTSDPVEVTLPECPAFYKR