Protein Info for BWI76_RS03090 in Klebsiella michiganensis M5al

Updated annotation (from data): 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 5 to 644 (640 residues), 957.6 bits, see alignment E=1.6e-292 PF02776: TPP_enzyme_N" amino acids 31 to 134 (104 residues), 54.9 bits, see alignment E=1.1e-18 PF00205: TPP_enzyme_M" amino acids 220 to 353 (134 residues), 117 bits, see alignment E=7.8e-38 PF02775: TPP_enzyme_C" amino acids 442 to 601 (160 residues), 121.7 bits, see alignment E=3.7e-39

Best Hits

Swiss-Prot: 62% identical to IOLD_GEOKA: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (iolD) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 94% identity to kva:Kvar_4580)

MetaCyc: 56% identical to 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (Bacillus subtilis subtilis 168)
RXN-14149 [EC: 3.7.1.22]

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.- or 3.7.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWX7 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BWI76_RS03090 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22) (Klebsiella michiganensis M5al)
MGKLRLTMAQALVKFLDNQYLEVDGEEHKFVKGIFAIFGHGNVLGMGQALEQDSGEMRVY
QGRNEQGMAHVATGFARQSLRRQIIACTSSIGPGAANMITAAATATANRIPLLLLPGDVF
ATRQPDPVLQQIEQSHDLSITTNDAFRAVSKYWDRITRPEQLMSACINAMRVLTDPAETG
AVTLCLPQDVQGEAWDYPESFFTRRVHRLDRRPASAAQLADAVAAIKASRKPLIVCGGGV
KYSGAGEALTRFAERYGVPFAETQAGKGSVVSSHPYNVGGVGETGCLAANLLAKEADLVI
GLGTRFSDFTTSSKWIFQHPGVRFLNINVSNFDAWKLDGIPMLADAREALTALDGALSGE
SWQAGWGEQIESVQSRQLKETQRVYQAVWQETAFVPEIDDHLDRESVYREFRQITDSTLT
QSSVLGVLNETLPADAVIVAAAGSLPGDLQRVWRNRAANTYHVEYGYSCMGYEVSAALGV
KLAQPQSEVYSLVGDGSFMMLHSELVTSLQERAKINIVLLDNMANGCINNLQMEHGMDSF
GTEFRFRCAESGQLQGGLVPVDFATVAAGYGCKTWRVTTLEELRHALDAARRETVSTLID
IKVLPKTMVHKYGSWWNVGVAQSALSERIRKVAQMINEKRAQARDY