Protein Info for BWI76_RS02855 in Klebsiella michiganensis M5al

Annotation: cytochrome B562

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07361: Cytochrom_B562" amino acids 24 to 128 (105 residues), 113.9 bits, see alignment E=2.7e-37

Best Hits

Swiss-Prot: 72% identical to C562_SALTI: Soluble cytochrome b562 (cybC) from Salmonella typhi

KEGG orthology group: None (inferred from 97% identity to kpn:KPN_04632)

MetaCyc: 68% identical to cytochrome b562 (soluble) (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Soluble cytochrome b562" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWU3 at UniProt or InterPro

Protein Sequence (128 amino acids)

>BWI76_RS02855 cytochrome B562 (Klebsiella michiganensis M5al)
MRKKLLAMLAVSAFALGSASAFADLGEDMDTLAENLQVVQKTSDAGELKAALNKMRTAAV
DAQKETPPKLEGKAADSAEMKDYRHGFDVLIGQIDGALKLADEGKVKEAQAAAEEFKTTR
NAYHKKYR