Protein Info for BWI76_RS02810 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter permease YjfF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 247 to 276 (30 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 304 (270 residues), 124.8 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 95% identical to YJFF_ECOLI: Inner membrane ABC transporter permease protein YjfF (yjfF) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 97% identity to enc:ECL_00634)

MetaCyc: 95% identical to galactofuranose ABC transporter putative membrane subunit YjtF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YjfF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWT4 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BWI76_RS02810 sugar ABC transporter permease YjfF (Klebsiella michiganensis M5al)
MIKRNLPLMITLAVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGG
IDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCAFGAFMGLLIDALKIPAFIIT
LAGMFFLRGVSYLVSEESIPINHPVYDALSGLAWTIPGGGRLSAMGLLMLLVVIGGIFMA
HRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAG
VGVELDAIASVVIGGTLLSGGVGTVLGTLFGVGIQGLIQTYINFDGTLSSWWTKIAIGIL
LFIFIALQRGLTVLWENRQSSPVTRVGH