Protein Info for BWI76_RS02765 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 56 to 82 (27 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details signal peptide" amino acids 26 to 27 (2 residues), see Phobius details PF01595: CNNM" amino acids 7 to 197 (191 residues), 149.3 bits, see alignment E=1.4e-47 PF00571: CBS" amino acids 284 to 333 (50 residues), 19.4 bits, see alignment 1.7e-07 PF03471: CorC_HlyC" amino acids 348 to 425 (78 residues), 78.5 bits, see alignment E=4.5e-26

Best Hits

Swiss-Prot: 91% identical to YTFL_ECO57: UPF0053 inner membrane protein YtfL (ytfL) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to kva:Kvar_4641)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWW0 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BWI76_RS02765 membrane protein (Klebsiella michiganensis M5al)
MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADDGNINAQRVLKMQENPGMFFTV
VQIGLNAVAILGGIVGDAAFSPAFYGLLSRYLSPELSEQLSFIISFTLVTSLFILFADLT
PKRIGMIAPEAVALRIINPMRFCLFIFRPLVWLFNGMANNIFRLFKIPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENVIWFDLHEDEQSLKNKVAE
HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLVLTGGVQIRNTLIVPDTLTLSEALE
SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP
IDDVMRVLDIDDFPQSGNYETIGGFMMFMLRKIPKRTDAVKFSGYKFEVVDIDNYRIDQL
LVTRIDNKPTVLVPKLPDAANSDKESA