Protein Info for BWI76_RS02680 in Klebsiella michiganensis M5al

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 301 (17 residues), see Phobius details PF00892: EamA" amino acids 14 to 155 (142 residues), 66.9 bits, see alignment E=1e-22 amino acids 169 to 302 (134 residues), 53.5 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_09460)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWQ1 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS02680 EamA family transporter (Klebsiella michiganensis M5al)
MDAPSIFTRKKVAYACATLCCLLWGSSYPAIKSGYELFQIATDDVPSKIVFAGYRFLFAG
ALLLLFALAQRKPIARLNSRQCGQLAILGVTQTSIQYIFFYVGLAFTTGVKGSIMNATGT
FFSVLLAHFIYQNDRLSYNKAVGCILGFAGVMLVNVNHSLSDFSFVWQGDGFVVLAAFIL
SAATLYGKRISQTVDPTVMTGWQLAFGGLVLVGGGYLTGGTLAVHSAAAALVLAYLTLLS
SIAFALWSVLLKHNRVSMIAPFNFVVPVAGTVLSAIFLGENILELKYAVALALVCTGIWW
VNKPGKASRLAGSVTRP