Protein Info for BWI76_RS02670 in Klebsiella michiganensis M5al

Annotation: 30S ribosomal protein S18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 TIGR00165: ribosomal protein bS18" amino acids 4 to 72 (69 residues), 126.5 bits, see alignment E=1.8e-41 PF01084: Ribosomal_S18" amino acids 18 to 68 (51 residues), 86.5 bits, see alignment E=5.3e-29

Best Hits

Swiss-Prot: 100% identical to RS18_PHOLL: 30S ribosomal protein S18 (rpsR) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K02963, small subunit ribosomal protein S18 (inferred from 100% identity to dda:Dd703_0796)

MetaCyc: 100% identical to 30S ribosomal subunit protein S18 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWT7 at UniProt or InterPro

Protein Sequence (75 amino acids)

>BWI76_RS02670 30S ribosomal protein S18 (Klebsiella michiganensis M5al)
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLSLLPYTDRHQ