Protein Info for BWI76_RS02485 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter (PAAT) family, periplasmic amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 23 to 243 (221 residues), 128.1 bits, E=9.4e-42

Best Hits

Swiss-Prot: 47% identical to ARTJ_ECOLI: ABC transporter arginine-binding protein 1 (artJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to kpe:KPK_5108)

MetaCyc: 47% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtI" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

See A0A285AWP5 at UniProt or InterPro

Protein Sequence (243 amino acids)

>BWI76_RS02485 polar amino acid ABC transporter (PAAT) family, periplasmic amino acid-binding protein (Klebsiella michiganensis M5al)
MKKALTVLLLATLATGTASATTLHFGTTTANPPFETVSGKNQPTGFDIDLANALCKQMQV
ECKFTPQGFDTLIPALRFKKFDAVIAGIEVIPMREKQVAFSHPYRQALSGVVVTAKDAAH
TFADLKDKKLGVVKGTLHQHYLRDKQKAVHAVPYDSDESALRALKEGVISGVMGDQETLT
KWLQDNPDYAMMDERATDPGYYGKQYAIAVRKDDPELLNNLNAALDVVKASPEFQAMEQK
WFK