Protein Info for BWI76_RS02480 in Klebsiella michiganensis M5al
Annotation: oligoribonuclease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to ORN_ENT38: Oligoribonuclease (orn) from Enterobacter sp. (strain 638)
KEGG orthology group: K13288, oligoribonuclease [EC: 3.1.-.-] (inferred from 96% identity to eco:b4162)MetaCyc: 96% identical to oligoribonuclease (Escherichia coli K-12 substr. MG1655)
Oligonucleotidase. [EC: 3.1.13.3]
Predicted SEED Role
"3'-to-5' oligoribonuclease (orn)" in subsystem RNA processing and degradation, bacterial
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.- or 3.1.13.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AWK5 at UniProt or InterPro
Protein Sequence (181 amino acids)
>BWI76_RS02480 oligoribonuclease (Klebsiella michiganensis M5al) MSADENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQSDAQLALMDE WNVRTHTGSGLVERVKASTQGDREAELATIEFLKKWVPAGKSPICGNSIGQDRRFLFKYM PELEAYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQAMDDIRESVAELAYYREHFIK L