Protein Info for BWI76_RS02445 in Klebsiella michiganensis M5al

Annotation: fumarate reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details PF02300: Fumarate_red_C" amino acids 3 to 128 (126 residues), 186.7 bits, see alignment E=8.5e-60

Best Hits

Swiss-Prot: 95% identical to FRDC_KLEP3: Fumarate reductase subunit C (frdC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 95% identity to kpn:KPN_04551)

MetaCyc: 84% identical to fumarate reductase membrane protein FrdC (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit C" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWS3 at UniProt or InterPro

Protein Sequence (131 amino acids)

>BWI76_RS02445 fumarate reductase subunit C (Klebsiella michiganensis M5al)
MTTKRKPYVRPMPSTWWKKLPFYRFYMLREGTAVPTVWFSIVLIYGLFALKHGAESWAGY
IGFLQNPIVVILNLITLAAALLHTKTWFELAPKAANIILKGEKMGPEPIIKGLWVVTAVV
TVVILFVALFW