Protein Info for BWI76_RS02190 in Klebsiella michiganensis M5al

Annotation: ribose 1,5-bisphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02322: phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN
  • amino acids 3 to 176 (174 residues), 228.9 bits, E=1.7e-72
• PF00625: Guanylate_kin
  • amino acids 4 to 151 (148 residues), 28.6 bits, E=1.7e-10
• PF13238: AAA_18
  • amino acids 6 to 138 (133 residues), 34.6 bits, E=4e-12

Best Hits

Swiss-Prot: 79% identical to PHNN_ENTLS: Ribose 1,5-bisphosphate phosphokinase PhnN (phnN) from Enterobacter lignolyticus (strain SCF1)

KEGG orthology group: None (inferred from 83% identity to eae:EAE_08690)

MetaCyc: 77% identical to ribose 1,5-bisphosphate phosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose 1,5-bisphosphate phosphokinase. [EC: 2.7.4.23]

Predicted SEED Role

"ATP-binding protein PhnN; Guanylate kinase (EC 2.7.4.8)" (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• methylphosphonate degradation I (5/5 steps found)
• (aminomethyl)phosphonate degradation (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• dZTP biosynthesis (3/5 steps found)
• glyphosate degradation III (4/7 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.8

Use Curated BLAST to search for 2.7.4.23 or 2.7.4.8

Sequence Analysis Tools

See A0A285AWI4 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BWI76_RS02190 ribose 1,5-bisphosphokinase (Klebsiella michiganensis M5al)
MTGKLIWLVGPSGSGKDSLLAALRQREHPQLLVAHRYITRPHNAGCENHIALSEHEFFTR
AEQHLFALSWHANNNYYGIGIEIDLWLHAGFDVVANGSRAHLAQAQARYADALLPICLQV
SPEVLRQRLEQRGRENETEIAQRLERAARYTPSACLTLNNDGRLSQSVDALVSLIRVHGN
RREQQIA