Protein Info for BWI76_RS02065 in Klebsiella michiganensis M5al

Annotation: fimbrial assembly chaperone SthB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00345: PapD_N" amino acids 21 to 138 (118 residues), 130 bits, see alignment E=5.2e-42 PF02753: PapD_C" amino acids 161 to 217 (57 residues), 40.2 bits, see alignment E=3.4e-14

Best Hits

Swiss-Prot: 38% identical to LPFB_SALTY: Chaperone protein LpfB (lpfB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 71% identity to kpu:KP1_0335)

Predicted SEED Role

"Putative fimbrial chaperone protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWG6 at UniProt or InterPro

Protein Sequence (228 amino acids)

>BWI76_RS02065 fimbrial assembly chaperone SthB (Klebsiella michiganensis M5al)
MNRLLCFVLFFFCISVSQASVVVGGTRVIFDGTKKTTTVSVQNKDNVTNIVQSWISIVDD
TSPAKDSFITTPPLFRLKAGEQGFVRILRSGKPLPEDRESMFWLNVKGIPAMDNEPDKNM
VQFAINSRIKLIYRPAALKNVIPENFSEKLQWSSEGREIKVKNNSPLYMNFSAIYINGKA
LPEAWFVAPYSTIKIPVASATSSGKREVTWSVINDYGMSGPKYTAIIQ