Protein Info for BWI76_RS02015 in Klebsiella michiganensis M5al

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 165 (25 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 390 to 417 (28 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 26 to 409 (384 residues), 302.4 bits, see alignment E=2.1e-94

Best Hits

Swiss-Prot: 93% identical to GHXP_ECO57: Guanine/hypoxanthine permease GhxP (ghxP) from Escherichia coli O157:H7

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 96% identity to esc:Entcl_4100)

MetaCyc: 93% identical to guanine/hypoxanthine transporter GhxP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Guanine-hypoxanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWF7 at UniProt or InterPro

Protein Sequence (449 amino acids)

>BWI76_RS02015 NCS2 family permease (Klebsiella michiganensis M5al)
MSTPSARTGGSLDAWFKISARGSTVRQEIVAGLTTFLAMVYSVIVVPGMLGKAGFPPAAV
FVSTCLVAGVGSLVMGLWANLPLAIGCAISLTAFTAFSLVLGQQISIPVALGAVFLMGVL
FTVISATGIRSWILRNLPQGVAHGTGIGIGLFLLLIAANGVGLVIKNPLDGLPVALGHFD
SFPVIMSLIGLAVIIGLEKLKVPGGILLTIIGVSIIGLIFDPNVHFTGIFAMPSLSDDKG
NSLIGSLDIVGALNPVVLPSVLALVMTAVFDATGTIRAVAGQANLLDKDGQIINGGKALT
TDSLSSVFSGLVGAAPAAVYIESAAGTAAGGKTGLTAVTVGVLFLLILFLSPLSYLVPAY
ATAPALMYVGLLMLSNVAKIDFNDFVDAMAGLITAVFIVLTCNIVTGIMIGFAALVIGRL
VSGEWRKLNLGTVIIAAALVIFYAGGWAI