Protein Info for BWI76_RS02005 in Klebsiella michiganensis M5al

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 96 to 117 (22 residues), see Phobius details PF02798: GST_N" amino acids 5 to 73 (69 residues), 60.4 bits, see alignment E=4.4e-20 PF13417: GST_N_3" amino acids 10 to 77 (68 residues), 52.5 bits, see alignment E=1.3e-17 PF13409: GST_N_2" amino acids 12 to 74 (63 residues), 54.3 bits, see alignment E=4.2e-18 PF14497: GST_C_3" amino acids 139 to 206 (68 residues), 25.7 bits, see alignment E=2.7e-09 PF00043: GST_C" amino acids 143 to 205 (63 residues), 32.8 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 31% identical to GST1_YEAST: Glutathione S-transferase 1 (GTT1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 82% identity to kva:Kvar_4782)

MetaCyc: 31% identical to glutathione transferase 1 monomer (Saccharomyces cerevisiae)
Glutathione transferase. [EC: 2.5.1.18]; 2.5.1.18 [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWD1 at UniProt or InterPro

Protein Sequence (222 amino acids)

>BWI76_RS02005 glutathione S-transferase (Klebsiella michiganensis M5al)
MLTVHHLNQSRSQRVLWALEELQLPYQVVSYQRGKDMLAPAELKSVHPLGKSPVVEDNGH
ILAESGAILEYLQETYDSARRLKPESVEDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGMRTLGNALGKGVQKAWLNRQLETHARFIEAHLSRQRWFAGAELSMADIQMSFPAM
ALLARGGVDDLPHLTQWVQRVEQRPAWQKAIERGGPFTLPGE