Protein Info for BWI76_RS01905 in Klebsiella michiganensis M5al

Annotation: envelope stress response protein PspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details PF09583: Phageshock_PspG" amino acids 1 to 64 (64 residues), 91.1 bits, see alignment E=2.3e-30 TIGR02975: phage shock protein G" amino acids 2 to 64 (63 residues), 86.6 bits, see alignment E=5.7e-29

Best Hits

Swiss-Prot: 79% identical to PSPG_ECOLI: Phage shock protein G (pspG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to kva:Kvar_4811)

Predicted SEED Role

"Phage shock protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWG8 at UniProt or InterPro

Protein Sequence (80 amino acids)

>BWI76_RS01905 envelope stress response protein PspG (Klebsiella michiganensis M5al)
MLELLFVIGFFVMLLVTGVSLLGIIAAIVVATALMFVGGLFALMIKLLPWLLLAIVVVWV
IRAIKSPAANRYRGNNRWRY