Protein Info for BWI76_RS01855 in Klebsiella michiganensis M5al

Annotation: chorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF04345: Chor_lyase" amino acids 24 to 165 (142 residues), 104.6 bits, see alignment E=2.3e-34

Best Hits

Swiss-Prot: 81% identical to UBIC_KLEP7: Chorismate pyruvate-lyase (ubiC) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_08410)

MetaCyc: 81% identical to chorismate lyase (Escherichia coli K-12 substr. MG1655)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWF8 at UniProt or InterPro

Protein Sequence (165 amino acids)

>BWI76_RS01855 chorismate lyase (Klebsiella michiganensis M5al)
MPHSALTQLRALRYFAEIPPLDAHLRDWLLLEDSMTKRFEQQGKKVSVIMVNEGFVGCEA
LAGEESLLPSEPRYWLREIILCANGEPWLAGRTIVPESTLSGPELALQQLGQTPLGRYLF
TSSTLTRDFIEIGRHAELWGRRSRLRLSGKPLLLTELFLPASPLY