Protein Info for BWI76_RS01845 in Klebsiella michiganensis M5al

Annotation: maltoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02264: LamB" amino acids 28 to 428 (401 residues), 450.7 bits, see alignment E=4.2e-139

Best Hits

Swiss-Prot: 80% identical to LAMB_ENT38: Maltoporin (lamB) from Enterobacter sp. (strain 638)

KEGG orthology group: K02024, maltoporin (inferred from 90% identity to enc:ECL_00293)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW77 at UniProt or InterPro

Protein Sequence (428 amino acids)

>BWI76_RS01845 maltoporin (Klebsiella michiganensis M5al)
MMITLRKLPLAVAVAAGVMSAQALAVDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLG
NECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTSPAFREANVQGKNLIEWL
PGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGKLSLAATRSSESGGSGTF
ADRDKFGNRVYDNIVPNDVFDVRLAGLETNPGGTLELGVDYGHTNIPDDYSLQPGASKDG
WMLTAEHTQSMLKGFNKFVLQYATDSMTSSGKGVPQGGSINNDGSMWRVLDHGAISLGDS
WDLMYVGMYQDIDRDNNNGTQWWTVGVRPMYKWTPIMSTLMEIGYDNVKSQRTSDRNSQY
KVTLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYNDSGVAYNDTSAKTFSRGDNDEWTF
GAQMEIWW