Protein Info for BWI76_RS01820 in Klebsiella michiganensis M5al

Updated annotation (from data): maltose ABC transporter, permease component 2 (MalG)
Rationale: Specifically important for utilizing D-Maltose monohydrate.
Original annotation: maltose transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 288 (178 residues), 56.6 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 98% identical to MALG_KLEAE: Maltose/maltodextrin transport system permease protein MalG (malG) from Klebsiella aerogenes

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 93% identity to ecf:ECH74115_5513)

MetaCyc: 93% identical to maltose ABC transporter membrane subunit MalG (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWB4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>BWI76_RS01820 maltose ABC transporter, permease component 2 (MalG) (Klebsiella michiganensis M5al)
MAMVQPKSQKLRLFTTHLLLLVFIAAIMFPLLMVIAISLREGNFATGSLIPESISWEHWR
LALGFSVEHADGRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKAT
LLKGMLIFQMFPAVLSLVALYALFDRLGQYVPFVGLNTHGGVIFAYMGGIALHVWTIKGY
FETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV
NSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLLAQRWLVNGLTAGGVKG